-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CLIC1 was raised in Rabbit using the recombinant Protein corresponding to a sequence within amino acids 42-241 of human CLIC1(NP_001279.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.
The antibody against CLIC1 was raised in Rabbit using the recombinant Protein corresponding to a sequence within amino acids 42-241 of human CLIC1(NP_001279.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.
| Cat.No | ADA-08125A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CLIC1 |
| Target Synonyms | G6; CL1C1; NCC27; CLCNL1; [KD Validated] CLIC1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, MCF7 | Application | ELISA, WB, IF/ICC, IP |
| Immunogen Description | Recombinant Protein corresponding to a sequence within amino acids 42-241 of human CLIC1(NP_001279.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK | Uniprot ID | O00299 |
Uniprot Id
O00299
Target Species
Human
Target Name
CLIC1
Target Full Name
Chloride intracellular channel protein 1
Target Function
Can insert into membranes and form chloride ion channels. Channel activity depends on the pH. Membrane insertion seems to be redox-regulated and may occur only under oxydizing conditions. Involved in regulation of the cell cycle.
Target Subcellular Location
Nucleus. Nucleus membrane; Single-pass membrane protein. Cytoplasm. Cell membrane; Single-pass membrane protein.
Target Protein Families
Chloride channel CLIC family
Target Tissue Specificity
Expression is prominent in heart, placenta, liver, kidney and pancreas.
Target Synonyms
CLIC1; G6; NCC27; Chloride intracellular channel protein 1; Chloride channel ABP; Nuclear chloride ion channel 27; Regulatory nuclear chloride ion channel protein; hRNCC
Target Background
Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 1 is a member of the p64 family; the protein localizes principally to the cell nucleus and exhibits both nuclear and plasma membrane chloride ion channel activity.
Notification