Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CLVS2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 265-327 of human CLVS2 (NP_001010852.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CLVS2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 265-327 of human CLVS2 (NP_001010852.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07126A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CLVS2 |
| Target Synonyms | RLBP1L2; C6orf212; C6orf213; bA160A10.4; CLVS2 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | U-251MG, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 265-327 of human CLVS2 (NP_001010852.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LLDHEYDDDSEYNVDSYSMPVKEVEKELSPKSMKRSQSVVDPTVLKRMDKNEEENMQPLLSLD | Uniprot ID | Q5SYC1 |
Uniprot Id
Q5SYC1
Target Species
Human
Target Name
CLVS2
Target Full Name
Clavesin-2
Target Function
Required for normal morphology of late endosomes and/or lysosomes in neurons. Binds phosphatidylinositol 3,5-bisphosphate (PtdIns(3,5)P2).
Target Subcellular Location
Golgi apparatus, trans-Golgi network membrane; Peripheral membrane protein. Cytoplasmic vesicle, clathrin-coated vesicle. Early endosome membrane; Peripheral membrane protein.
Target Research Area
Signal Transduction
Target Synonyms
bA160A10.4; C6orf212; C6orf213; Clavesin-2; clvs2; CLVS2_HUMAN; Retinaldehyde-binding protein 1-like 2; RLBP1L2
Target Background
This gene encodes a protein that belongs to the SEC14/CRAL-TRIO family of proteins. A similar protein in rat is thought to function in the endosomal pathway between early endosomes and mature lysosomes.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
