-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CORO1A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 362-461 of human CORO1A (NP_001180262.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against CORO1A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 362-461 of human CORO1A (NP_001180262.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-08927A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CORO1A |
| Target Synonyms | p57; IMD8; TACO; CLABP; HCORO1; CLIPINA; CORO1A | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HL-60, Mouse brain, Mouse lung, Rat lung, SW480 | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 362-461 of human CORO1A (NP_001180262.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DLYPPTAGPDPALTAEEWLGGRDAGPLLISLKDGYVPPKSRELRVNRGLDTGRRRAAPEASGTPSSDAVSRLEEEMRKLQATVQELQKRLDRLEETVQAK | Uniprot ID | P31146 |
Uniprot Id
P31146
Target Species
Human
Target Name
CORO1A
Target Full Name
Coronin-1A
Target Function
May be a crucial component of the cytoskeleton of highly motile cells, functioning both in the invagination of large pieces of plasma membrane, as well as in forming protrusions of the plasma membrane involved in cell locomotion. In mycobacteria-infected cells, its retention on the phagosomal membrane prevents fusion between phagosomes and lysosomes.
Target Involvement
Immunodeficiency 8 (IMD8)
Target Subcellular Location
Cytoplasm, cytoskeleton. Cytoplasm, cell cortex. Cytoplasmic vesicle, phagosome membrane.
Target Protein Families
WD repeat coronin family
Target Tissue Specificity
Expressed in brain, thymus, spleen, bone marrow and lymph node. Low in lung and gut.
Target Synonyms
Actin binding protein ; CLABP; Clipin A; Clipin-A; CLIPINA; COR1A_HUMAN; CORO1A; Coronin 1; Coronin actin binding protein 1A ; Coronin like protein A; Coronin like protein p57; Coronin-1A; Coronin-like protein A; Coronin-like protein p57; FLJ41407; HCORO1; MGC117380; OTTHUMP00000163017; p57; TACO; Tryptophan aspartate containing coat protein; Tryptophan aspartate-containing coat protein
Target Background
This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. Alternative splicing results in multiple transcript variants. A related pseudogene has been defined on chromosome 16.
Notification