Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CRIP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-77 of human CRIP1 (NP_001302.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CRIP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-77 of human CRIP1 (NP_001302.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09313A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CRIP1 |
| Target Synonyms | CRHP; CRIP; CRP1; CRP-1; CRIP1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse lung, Mouse ovary, OVCAR-3, PC-3 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-77 of human CRIP1 (NP_001302.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MPKCPKCNKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYAAMFGPKGFGRGGAESHTFK | Uniprot ID | P50238 |
Uniprot Id
P50238
Target Species
Human
Target Name
CRIP1
Target Full Name
Cysteine-rich protein 1
Target Function
Seems to have a role in zinc absorption and may function as an intracellular zinc transport protein.
Target Research Area
Signal Transduction
Target Synonyms
CRHP; CRIP; CRIP1; CRIP1_HUMAN; CRP-1; CRP1; Cysteine rich heart protein; Cysteine rich intestinal protein; Cysteine rich protein 1 (intestinal); Cysteine rich protein 1; Cysteine-rich heart protein; Cysteine-rich intestinal protein; Cysteine-rich protein 1; FLJ40971; hCRHP
Target Background
Cysteine-rich intestinal protein (CRIP) belongs to the LIM/double zinc finger protein family, members of which include cysteine- and glycine-rich protein-1 (CSRP1; MIM 123876), rhombotin-1 (RBTN1; MIM 186921), rhombotin-2 (RBTN2; MIM 180385), and rhombotin-3 (RBTN3; MIM 180386). CRIP may be involved in intestinal zinc transport (Hempe and Cousins, 1991 [PubMed 1946385]).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
