Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CRIPT was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-101 of human CRIPT (NP_054890.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CRIPT was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-101 of human CRIPT (NP_054890.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05705A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CRIPT |
| Target Synonyms | SSMDF; HSPC139; CRIPT | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat heart, Mouse lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-101 of human CRIPT (NP_054890.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MVCEKCEKKLGTVITPDTWKDGARNTTESGGRKLNENKALTSKKARFDPYGKNKFSTCRICKSSVHQPGSHYCQGCAYKKGICAMCGKKVLDTKNYKQTSV | Uniprot ID | Q9P021 |
Uniprot Id
Q9P021
Target Species
Human
Target Name
CRIPT
Target Full Name
Cysteine-rich PDZ-binding protein
Target Function
Involved in the cytoskeletal anchoring of DLG4 in excitatory synapses.
Target Involvement
Short stature with microcephaly and distinctive facies (SSMF)
Target Subcellular Location
Cytoplasm. Cell junction, synapse. Cell projection, dendritic spine.
Target Protein Families
CRIPT family
Target Synonyms
CRIPT; HSPC139; Cysteine-rich PDZ-binding protein; Cysteine-rich interactor of PDZ three; Cysteine-rich interactor of PDZ3
Target Background
This gene encodes a protein that binds to the PDZ3 peptide recognition domain. The encoded protein may modulates protein interactions with the cytoskeleton. A mutation in this gene resulted in short stature with microcephaly and distinctive facies.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
