Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CROT was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-87 of human CROT (NP_001230674.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.
The antibody against CROT was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-87 of human CROT (NP_001230674.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.
| Cat.No | ADA-03895A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CROT |
| Target Synonyms | COT; CROT | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat liver | Application | ELISA, WB, IP |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-87 of human CROT (NP_001230674.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MENQLAKSTEERTFQYQDSLPSLPVPSLEESLKKYLESVKPFANQEEYKKTEEIVQKFQSGIGEKLHQKLLERAKGKRNWVFVVIIE | Uniprot ID | Q9UKG9 |
Uniprot Id
Q9UKG9
Target Species
Human
Target Name
CROT
Target Full Name
Peroxisomal carnitine O-octanoyltransferase
Target Function
Beta-oxidation of fatty acids. The highest activity concerns the C6 to C10 chain length substrate. Converts the end product of pristanic acid beta oxidation, 4,8-dimethylnonanoyl-CoA, to its corresponding carnitine ester.
Target Subcellular Location
Peroxisome.
Target Protein Families
Carnitine/choline acetyltransferase family
Target Research Area
Tags & Cell Markers
Target Synonyms
Carnitine O octanoyltransferase; COT; CROT; OCTC_HUMAN; Peroxisomal carnitine acyltransferase; Peroxisomal carnitine O octanoyltransferase; Peroxisomal carnitine O-octanoyltransferase
Target Background
This gene encodes a member of the carnitine/choline acetyltransferase family. The encoded protein converts 4, 8-dimethylnonanoyl-CoA to its corresponding carnitine ester. This transesterification occurs in the peroxisome and is necessary for transport of medium- and long- chain acyl-CoA molecules out of the peroxisome to the cytosol and mitochondria. The protein thus plays a role in lipid metabolism and fatty acid beta-oxidation. Alternatively spliced transcript variants have been described.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
