-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CRYGS was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-178 of human CRYGS (NP_060011.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CRYGS was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-178 of human CRYGS (NP_060011.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10966A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CRYGS |
| Target Synonyms | CRYG8; CTRCT20; CRYGS | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse eye, Rat eye | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-178 of human CRYGS (NP_060011.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSKTGTKITFYEDKNFQGRRYDCDCDCADFHTYLSRCNSIKVEGGTWAVYERPNFAGYMYILPQGEYPEYQRWMGLNDRLSSCRAVHLPSGGQYKIQIFEKGDFSGQMYETTEDCPSIMEQFHMREIHSCKVLEGVWIFYELPNYRGRQYLLDKKEYRKPIDWGAASPAVQSFRRIVE | Uniprot ID | P22914 |
Uniprot Id
P22914
Target Species
Human
Target Name
CRYGS
Target Full Name
Gamma-crystallin S
Target Function
Crystallins are the dominant structural components of the vertebrate eye lens.
Target Involvement
Cataract 20, multiple types (CTRCT20)
Target Protein Families
Beta/gamma-crystallin family
Target Synonyms
AI327013; Beta-crystallin S; CRBS_HUMAN; CRYG8; crygs; Crystallin; gamma 8; Crystallin; gamma polypeptide 8; Crystallin; gamma S; CTRCT20; Gamma crystallin S; Gamma S crystallin; Gamma-crystallin S; Gamma-S-crystallin; Opacity due to poor secondary fiber cell junction; recessive nuclear cataract; Opj; rncat
Target Background
Crystallins are separated into two classes: taxon-specific, or enzyme, and ubiquitous. The latter class constitutes the major proteins of vertebrate eye lens and maintains the transparency and refractive index of the lens. Since lens central fiber cells lose their nuclei during development, these crystallins are made and then retained throughout life, making them extremely stable proteins. Mammalian lens crystallins are divided into alpha, beta, and gamma families; beta and gamma crystallins are also considered as a superfamily. Alpha and beta families are further divided into acidic and basic groups. Seven protein regions exist in crystallins: four homologous motifs, a connecting peptide, and N- and C-terminal extensions. Gamma-crystallins are a homogeneous group of highly symmetrical, monomeric proteins typically lacking connecting peptides and terminal extensions. They are differentially regulated after early development. This gene encodes a protein initially considered to be a beta-crystallin but the encoded protein is monomeric and has greater sequence similarity to other gamma-crystallins. This gene encodes the most significant gamma-crystallin in adult eye lens tissue. Whether due to aging or mutations in specific genes, gamma-crystallins have been involved in cataract formation.
Notification