-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CSRNP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human CSRNP1 (NP_149016.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against CSRNP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human CSRNP1 (NP_149016.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-02667A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CSRNP1 |
| Target Synonyms | AXUD1; URAX1; TAIP-3; CSRNP-1; FAM130B; CSRNP1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HEL, Molt-4(Negative control), Mouse thymus, U2OS | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human CSRNP1 (NP_149016.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MTGLLKRKFDQLDEDNSSVSSSSSSSGCQSRSCSPSSSVSRAWDSEEEGPWDQMPLPDRDFCGPRSFTPLSILKRARRERPGRVAFDGITVFYFPRCQGFTSVPSRGGCTLGMALRHSACRRFSLAEFAQEQARARHEKLRQRLKEEKLEMLQWKLSAAGVPQAEAGLPPVVDAIDDASVEEDLAVAVAGGRLEEVSFLQ | Uniprot ID | Q96S65 |
Uniprot Id
Q96S65
Target Species
Human
Target Name
CSRNP1
Target Full Name
Cysteine/serine-rich nuclear protein 1
Target Function
Binds to the consensus sequence 5'-AGAGTG-3' and has transcriptional activator activity. May have a tumor-suppressor function. May play a role in apoptosis.
Target Subcellular Location
Nucleus.
Target Protein Families
AXUD1 family
Target Tissue Specificity
Ubiquitous. Most abundantly expressed in lung, placenta, skeletal muscle, pancreas and leukocyte. Frequently down-regulated in lung, kidney, liver and colon cancers compared with their corresponding normal tissues.
Target Synonyms
4931429D10Rik; Axin 1 Up-regulated; Axin-1 up-regulated gene 1 protein; CSRN1_HUMAN; CSRNP-1; CSRNP1; Cysteine/serine-rich nuclear protein 1; DKFZp566F164; FAM130B; Protein URAX1; TAIP 3; TAIP-3; TGF beta induced apoptosis protein 3; TGF-beta-induced apoptosis protein 3; URAX1
Target Background
This gene encodes a protein that localizes to the nucleus and expression of this gene is induced in response to elevated levels of axin. The Wnt signalling pathway, which is negatively regulated by axin, is important in axis formation in early development and impaired regulation of this signalling pathway is often involved in tumors. A decreased level of expression of this gene in tumors compared to the level of expression in their corresponding normal tissues suggests that this gene product has a tumor suppressor function. Alternative splicing results in multiple transcript variants.
Notification