Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CSTF2T was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 420-560 of human CSTF2T (NP_056050.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against CSTF2T was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 420-560 of human CSTF2T (NP_056050.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-03935A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CSTF2T |
| Target Synonyms | CstF-64T; CSTF2T | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | BT-474, Jurkat, K-562, Mouse liver, SW620, U-87MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 420-560 of human CSTF2T (NP_056050.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TRAMETEVLETRVMERRGMETCAMETRGMEARGMDARGLEMRGPVPSSRGPMTGGIQGPGPINIGAGGPPQGPRQVPGISGVGNPGAGMQGTGIQGTGMQGAGIQGGGMQGAGIQGVSIQGGGIQGGGIQGASKQGGSQPS | Uniprot ID | Q9H0L4 |
Uniprot Id
Q9H0L4
Target Species
Human
Target Name
CSTF2T
Target Full Name
Cleavage stimulation factor subunit 2 tau variant
Target Function
May play a significant role in AAUAAA-independent mRNA polyadenylation in germ cells. Directly involved in the binding to pre-mRNAs.
Target Subcellular Location
Nucleus.
Target Synonyms
CF 1 64 kDa subunit tau; CF-1 64 kDa subunit tau variant; CF1 64 kDa subunit; tau variant; Cleavage stimulation factor 3' pre RNA; subunit 2 64kDa tau variant; Cleavage stimulation factor 64 kDa subunit tau; Cleavage stimulation factor 64 kDa subunit tau variant; Cleavage stimulation factor 64 kDa subunit; tau variant; Cleavage stimulation factor subunit 2 tau; Cleavage stimulation factor subunit 2 tau variant; CSTF 64 kDa subunit tau; CSTF 64 kDa subunit tau variant; CSTF 64 kDa subunit; tau variant; CstF 64T; CSTF2T; CSTF2T f; CSTFT_HUMAN; KIAA0689; TauCstF-64; TauCstF64
Target Background
Enables RNA binding activity. Predicted to be involved in pre-mRNA cleavage required for polyadenylation. Located in nucleoplasm.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
