Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CTNNBIP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-81 of human CTNNBIP1 (NP_064633.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CTNNBIP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-81 of human CTNNBIP1 (NP_064633.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09371A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CTNNBIP1 |
| Target Synonyms | ICAT; CTNNBIP1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-81 of human CTNNBIP1 (NP_064633.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSIDQGAEDVVMAFSRSETEDRRQ | Uniprot ID | Q9NSA3 |
Uniprot Id
Q9NSA3
Target Species
Human
Target Name
CTNNBIP1
Target Full Name
Beta-catenin-interacting protein 1
Target Function
Prevents the interaction between CTNNB1 and TCF family members, and acts as negative regulator of the Wnt signaling pathway.
Target Subcellular Location
Cytoplasm. Nucleus.
Target Protein Families
CTNNBIP1 family
Target Research Area
Signal Transduction
Target Synonyms
Beta catenin interacting protein 1; Beta catenin interacting protein ICAT; Beta-catenin-interacting protein 1; Catenin beta interacting protein 1; CNBP1_HUMAN; CTNNBIP 1; CTNNBIP1; ICAT; Inhibitor of beta catenin and Tcf 4; Inhibitor of beta-catenin and Tcf-4; MGC15093
Target Background
The protein encoded by this gene binds CTNNB1 and prevents interaction between CTNNB1 and TCF family members. The encoded protein is a negative regulator of the Wnt signaling pathway. Two transcript variants encoding the same protein have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
