Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CUTA was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 21-156 of human CUTA (NP_001014840.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CUTA was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 21-156 of human CUTA (NP_001014840.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02645A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CUTA |
| Target Synonyms | ACHAP; C6orf82; CUTA | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse pancreas | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 21-156 of human CUTA (NP_001014840.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FVWMPALLPVASRLLLLPRVLLTMASGSPPTQPSPASDSGSGYVPGSVSAAFVTCPNEKVAKEIARAVVEKRLAACVNLIPQITSIYEWKGKIEEDSEVLMMIKTQSSLVPALTDFVRSVHPYEVAEVIALPVEQG | Uniprot ID | O60888 |
Uniprot Id
O60888
Target Species
Human
Target Name
CUTA
Target Full Name
Protein CutA
Target Function
May form part of a complex of membrane proteins attached to acetylcholinesterase (AChE).
Target Protein Families
CutA family
Target Tissue Specificity
Ubiquitous. Widely expressed in brain.
Target Synonyms
Acetylcholinesterase Associated Protein; Acetylcholinesterase-associated protein; ACHAP; Brain acetylcholinesterase putative membrane anchor; C6ORF82; cutA; CutA Divalent Cation Tolerance Homolog; cutA divalent cation tolerance homolog (E. coli); CUTA_HUMAN; CutA1; divalent cation tolerant protein CUTA; MGC111154; OTTHUMP00000039621; Protein CutA; RP4570F34
Target Background
Enables enzyme binding activity. Involved in protein localization. Located in membrane.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
