-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Cyclophilin 40 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 271-370 of human Cyclophilin 40 (Q08752) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against Cyclophilin 40 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 271-370 of human Cyclophilin 40 (Q08752) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-16095A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Cyclophilin 40 |
| Target Synonyms | CYPD; CYP-40; Cyclophilin 40 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | C6, NIH/3T3, Rat brain, Jurkat, Mouse brain | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 271-370 of human Cyclophilin 40 (Q08752). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | IALSCVLNIGACKLKMSNWQGAIDSCLEALELDPSNTKALYRRAQGWQGLKEYDQALADLKKAQGIAPEDKAIQAELLKVKQKIKAQKDKEKAVYAKMFA | Uniprot ID | Q08752 |
Uniprot Id
Q08752
Target Species
Human
Target Name
PPID
Target Full Name
Peptidyl-prolyl cis-trans isomerase D
Target Function
PPIase that catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and may therefore assist protein folding. Proposed to act as a co-chaperone in HSP90 complexes such as in unligated steroid receptors heterocomplexes. Different co-chaperones seem to compete for association with HSP90 thus establishing distinct HSP90-co-chaperone-receptor complexes with the potential to exert tissue-specific receptor activity control. May have a preference for estrogen receptor complexes and is not found in glucocorticoid receptor complexes. May be involved in cytoplasmic dynein-dependent movement of the receptor from the cytoplasm to the nucleus. May regulate MYB by inhibiting its DNA-binding activity. Involved in regulation of AHR signaling by promoting the formation of the AHR:ARNT dimer; the function is independent of HSP90 but requires the chaperone activity. Involved in regulation of UV radiation-induced apoptosis. Promotes cell viability in anaplastic lymphoma kinase-positive anaplastic large-cell lymphoma (ALK+ ALCL) cell lines.; (Microbial infection) May be involved in hepatitis C virus (HCV) replication and release.
Target Subcellular Location
Cytoplasm. Nucleus, nucleolus. Nucleus, nucleoplasm.
Target Protein Families
Cyclophilin-type PPIase family, PPIase D subfamily
Target Tissue Specificity
Widely expressed.
Target Synonyms
CYPD; CYP-40; Cyclophilin 40
Target Background
The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein has been shown to possess PPIase activity and, similar to other family members, can bind to the immunosuppressant cyclosporin A.
Notification