-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CYP2F1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 100-290 of human CYP2F1 (NP_000765.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against CYP2F1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 100-290 of human CYP2F1 (NP_000765.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-02436A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CYP2F1 |
| Target Synonyms | C2F1; CYP2F; CYPIIF1; CYP2F1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, BT-474, Mouse liver, Mouse lung, Rat liver, SW620 | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 100-290 of human CYP2F1 (NP_000765.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DYPAFFNFTKGNGIAFSSGDRWKVLRQFSIQILRNFGMGKRSIEERILEEGSFLLAELRKTEGEPFDPTFVLSRSVSNIICSVLFGSRFDYDDERLLTIIRLINDNFQIMSSPWGELYDIFPSLLDWVPGPHQRIFQNFKCLRDLIAHSVHDHQASLDPRSPRDFIQCFLTKMAEEKEDPLSHFHMDTLLM | Uniprot ID | P24903 |
Uniprot Id
P24903
Target Species
Human
Target Name
CYP2F1
Target Full Name
Cytochrome P450 2F1
Target Function
May be involved in the metabolism of various pneumotoxicants including naphthalene. Is able to dealkylate ethoxycoumarin, propoxycoumarin, and pentoxyresorufin but possesses no activity toward ethoxyresorufin and only trace dearylation activity toward benzyloxyresorufin. Bioactivates 3-methylindole (3MI) by dehydrogenation to the putative electrophile 3-methylene-indolenine.
Target Subcellular Location
Endoplasmic reticulum membrane; Peripheral membrane protein. Microsome membrane; Peripheral membrane protein.
Target Protein Families
Cytochrome P450 family
Target Tissue Specificity
Expressed in lung. Rarely detected in liver and placenta.
Target Synonyms
CYP2F1Cytochrome P450 2F1; EC 1.14.14.1; CYPIIF1
Target Background
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is known to dehydrogenate 3-methylindole, an endogenous toxin derived from the fermentation of tryptophan, as well as xenobiotic substrates such as naphthalene and ethoxycoumarin. This gene is part of a large cluster of cytochrome P450 genes from the CYP2A, CYP2B and CYP2F subfamilies on chromosome 19q.
Notification