Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Cytokeratin 9 (KRT9) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 254-412 of human Cytokeratin 9 (KRT9) (P35527) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Cytokeratin 9 (KRT9) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 254-412 of human Cytokeratin 9 (KRT9) (P35527) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14044A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Cytokeratin 9 (KRT9) |
| Target Synonyms | K9; CK-9; EPPK; Cytokeratin 9 (KRT9) | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 254-412 of human Cytokeratin 9 (KRT9) (P35527). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DADINGLRQVLDNLTMEKSDLEMQYETLQEELMALKKNHKEEMSQLTGQNSGDVNVEINVAPGKDLTKTLNDMRQEYEQLIAKNRKDIENQYETQITQIEHEVSSSGQEVQSSAKEVTQLRHGVQELEIELQSQLSKKAALEKSLEDTKNRYCGQLQMI | Uniprot ID | P35527 |
Uniprot Id
P35527
Target Species
Human
Target Name
KRT9
Target Full Name
Keratin, type I cytoskeletal 9
Target Function
May serve an important special function either in the mature palmar and plantar skin tissue or in the morphogenetic program of the formation of these tissues. Plays a role in keratin filament assembly.
Target Involvement
Keratoderma, palmoplantar, epidermolytic (EPPK)
Target Protein Families
Intermediate filament family
Target Tissue Specificity
Expressed in the terminally differentiated epidermis of palms and soles.
Target Synonyms
CK 9; CK-9; Cytokeratin 9; Cytokeratin-9; Cytokeratin9; EPPK; K1C9_HUMAN; K9; Keratin 9; Keratin; Keratin type I cytoskeletal 9; Keratin-9; Keratin9; KRT 9; Krt9; Spermatid Perinuclear Ring Manchette Protein K9; type I cytoskeletal 9
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
