Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DAP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-102 of human DAP (NP_004385.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against DAP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-102 of human DAP (NP_004385.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-09528A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DAP |
| Target Synonyms | DAP1; DAP | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, NIH/3T3, 293T, Rat testis | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-102 of human DAP (NP_004385.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSSPPEGKLETKAGHPPAVKAGGMRIVQKHPHTGDTKEEKDKDDQEWESPSPPKPTVFISGVIARGDKDFPPAAAQVAHQKPHASMDKHPSPRTQHIQQPRK | Uniprot ID | P51397 |
Uniprot Id
P51397
Target Species
Human
Target Name
DAP
Target Full Name
Death-associated protein 1
Target Function
Negative regulator of autophagy. Involved in mediating interferon-gamma-induced cell death.
Target Research Area
Apoptosis
Target Synonyms
DAP 1; Dap; DAP-1; DAP1_HUMAN; Death associated protein 1; Death associated protein; Death-associated protein 1; MGC99796; OTTHUMP00000161670; OTTHUMP00000221331
Target Background
This gene encodes a basic, proline-rich, 15-kD protein. The protein acts as a positive mediator of programmed cell death that is induced by interferon-gamma. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
