-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DAZ1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 340-530 of human DAZ1 (NP_004072.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against DAZ1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 340-530 of human DAZ1 (NP_004072.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03838A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DAZ1 |
| Target Synonyms | DAZ; SPGY; DAZ1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 22Rv1, ES-2 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 340-530 of human DAZ1 (NP_004072.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NSTISREASTQSSSAAASQGWVLPEGKIVPNTVFVGGIDARMDETEIGSCFGRYGSVKEVKIITNRTGVSKGYGFVSFVNDVDVQKIVGSQIHFHGKKLKLGPAIRKQKLCARHVQPRPLVVNPPPPPQFQNVWRNPNTETYLQPQITPNPVTQHVQSAANPETPNSTISREASTQSSSAAASQGWVLPEG | Uniprot ID | Q9NQZ3 |
Uniprot Id
Q9NQZ3
Target Species
Human
Target Name
DAZ1
Target Full Name
Deleted in azoospermia protein 1
Target Function
RNA-binding protein that plays an essential role in spermatogenesis. May act by binding to the 3'-UTR of mRNAs and regulating their translation. Promotes germ-cell progression to meiosis and formation of haploid germ cells.
Target Involvement
Spermatogenic failure Y-linked 2 (SPGFY2)
Target Subcellular Location
Cytoplasm. Nucleus. Note=Predominantly cytoplasmic. Nuclear at some stages of spermatozoide development. Localizes both to the nuclei and cytoplasm of spermatozoide differentiation. Nuclear in fetal gonocytes and in spermatogonial nuclei. It then relocates to the cytoplasm during male meiosis.
Target Protein Families
RRM DAZ family
Target Tissue Specificity
Testis-specific. Expression restricted to premeiotic germ cells, particularly in spermatogonia (at protein level).
Target Synonyms
DAZ1; DAZ; SPGYDeleted in azoospermia protein 1
Target Background
This gene is a member of the DAZ gene family and is a candidate for the human Y-chromosomal azoospermia factor (AZF). Its expression is restricted to premeiotic germ cells, particularly in spermatogonia. It encodes an RNA-binding protein that is important for spermatogenesis. Four copies of this gene are found on chromosome Y within palindromic duplications; one pair of genes is part of the P2 palindrome and the second pair is part of the P1 palindrome. Each gene contains a 2.4 kb repeat including a 72-bp exon, called the DAZ repeat; the number of DAZ repeats is variable and there are several variations in the sequence of the DAZ repeat. Each copy of the gene also contains a 10.8 kb region that may be amplified; this region includes five exons that encode an RNA recognition motif (RRM) domain. This gene contains three copies of the 10.8 kb repeat. However, no transcripts containing three copies of the RRM domain have been described; thus the RefSeq for this gene contains only two RRM domains.
Notification