Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DCTN5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human DCTN5 (NP_115875.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against DCTN5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human DCTN5 (NP_115875.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04747A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DCTN5 |
| Target Synonyms | DCTN5 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, 293T, MCF7, Mouse eye, Mouse testis, Rat lung, Rat spleen | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human DCTN5 (NP_115875.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MELGELLYNKSEYIETASGNKVSRQSVLCGSQNIVLNGKTIVMNDCIIRGDLANVRVGRHCVVKSRSVIRPPFKKFSKGVAFFPLHIGDHVFIEEDCVVN | Uniprot ID | Q9BTE1 |
Uniprot Id
Q9BTE1
Target Species
Human
Target Name
DCTN5
Target Full Name
Dynactin subunit 5
Target Subcellular Location
Cytoplasm, cytoskeleton. Chromosome, centromere, kinetochore.
Target Protein Families
Dynactin subunits 5/6 family, Dynactin subunit 5 subfamily
Target Synonyms
DCTN 5; DCTN5; DCTN5_HUMAN; Dynactin 4; Dynactin 5 (p25); Dynactin subunit 5; Dynactin subunit p25; p25
Target Background
This gene encodes a subunit of dynactin, a component of the cytoplasmic dynein motor machinery involved in minus-end-directed transport. The encoded protein is a component of the pointed-end subcomplex and is thought to bind membranous cargo. A pseudogene of this gene is located on the long arm of chromosome 1. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
