Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DHTKD1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 32-197 of human DHTKD1 (NP_061176.4) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against DHTKD1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 32-197 of human DHTKD1 (NP_061176.4) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
Western blot analysis of various lysates, using DHTKD1 Rabbit mAb at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 15s.
| Cat.No | ADA-15622A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DHTKD1 |
| Target Synonyms | E1a; AAKAD; CMT2Q; AMOXAD; OADC-E1; OADH-E1; DHTKD1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, MCF7, Rat kidney, T-47D | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 32-197 of human DHTKD1 (NP_061176.4) | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GYRPRKPESREPQGALERPPVDHGLARLVTVYCEHGHKAAKINPLFTGQALLENVPEIQALVQTLQGPFHTAGLLNMGKEEASLEEVLVYLNQIYCGQISIETSQLQSQDEKDWFAKRFEELQKETFTTEERKHLSKLMLESQEFDHFLATKFSTVKRYGGEGAES | Uniprot ID | Q96HY7 |
Uniprot Id
Q96HY7
Target Species
Human
Target Name
DHTKD1
Target Full Name
2-oxoadipate dehydrogenase complex component E1
Target Function
The 2-oxoglutarate dehydrogenase complex catalyzes the overall conversion of 2-oxoglutarate to succinyl-CoA and CO(2). It contains multiple copies of three enzymatic components: 2-oxoglutarate dehydrogenase (E1), dihydrolipoamide succinyltransferase (E2) and lipoamide dehydrogenase (E3).
Target Involvement
Charcot-Marie-Tooth disease 2Q (CMT2Q); 2-aminoadipic 2-oxoadipic aciduria (AMOXAD)
Target Subcellular Location
Mitochondrion.
Target Protein Families
Alpha-ketoglutarate dehydrogenase family
Target Synonyms
AMOXAD; CMT2Q; Dehydrogenase E1 and transketolase domain containing 1; Dehydrogenase E1 and transketolase domain containing protein 1; Dehydrogenase E1 and transketolase domain-containing protein 1; DHTK1_HUMAN; dhtkd1; DKFZp762M115; KIAA1630; MGC3090; Probable 2 oxoglutarate dehydrogenase E1 component DHKTD1 mitochondrial; Probable 2-oxoglutarate dehydrogenase E1 component DHKTD1; mitochondrial
Target Background
This gene encodes a component of a mitochondrial 2-oxoglutarate-dehydrogenase-complex-like protein involved in the degradation pathways of several amino acids, including lysine. Mutations in this gene are associated with 2-aminoadipic 2-oxoadipic aciduria and Charcot-Marie-Tooth Disease Type 2Q.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
