Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DMKN was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 355-449 of human DMKN (NP_001177276.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against DMKN was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 355-449 of human DMKN (NP_001177276.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05976A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DMKN |
| Target Synonyms | UNQ729; ZD52F10; DMKN | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 355-449 of human DMKN (NP_001177276.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | WEDFKQNTPFLNWKAIIEGADASSLQKRAGRADQPGAGWQEVAAVTSKNYNYNQHAYPTAYGGKYSVKTPAKGGVSPSSSASRVQPGLLQWVKFW | Uniprot ID | Q6E0U4 |
Uniprot Id
Q6E0U4
Target Species
Human
Target Name
DMKN
Target Full Name
Dermokine
Target Function
May act as a soluble regulator of keratinocyte differentiation.
Target Subcellular Location
Secreted.
Target Protein Families
Dermokine family
Target Tissue Specificity
Expressed in epidermis; in the spinous and granular layers and in placenta. Also found in the epithelia of the small intestine, macrophages of the lung and endothelial cells of the lung. Isoform 15 is expressed in epidermis and placenta. Isoform 1 is expr
Target Synonyms
Dermokine; DMKN; DMKN_HUMAN; Epidermis-specific secreted protein SK30/SK89; FLJ79374; UNQ729; UNQ729/PRO1411; ZD52F10
Target Background
This gene is upregulated in inflammatory diseases, and it was first observed as expressed in the differentiated layers of skin. The most interesting aspect of this gene is the differential use of promoters and terminators to generate isoforms with unique cellular distributions and domain components. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
