-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DPP6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 117-210 of human DPP6 (NP_001277182.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against DPP6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 117-210 of human DPP6 (NP_001277182.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01335A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DPP6 |
| Target Synonyms | VF2; DPL1; DPPX; MRD33; DPP6 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 117-210 of human DPP6 (NP_001277182.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LTPAEDNSLSQKKKVTVEDLFSEDFKIHDPEAKWISDTEFIYREQKGTVRLWNVETNTSTVLIEGKKIESLRAIRYEISPDREYALFSYNVEPM | Uniprot ID | P42658 |
Uniprot Id
P42658
Target Species
Human
Target Name
DPP6
Target Full Name
A-type potassium channel modulatory protein DPP6
Target Function
Promotes cell surface expression of the potassium channel KCND2. Modulates the activity and gating characteristics of the potassium channel KCND2. Has no dipeptidyl aminopeptidase activity.
Target Involvement
Familial paroxysmal ventricular fibrillation 2 (VF2); Mental retardation, autosomal dominant 33 (MRD33)
Target Subcellular Location
Cell membrane; Single-pass type II membrane protein.
Target Protein Families
Peptidase S9B family
Target Tissue Specificity
Expressed predominantly in brain.
Target Synonyms
DPP6Dipeptidyl aminopeptidase-like protein 6; DPPX; Dipeptidyl aminopeptidase-related protein; Dipeptidyl peptidase 6; Dipeptidyl peptidase IV-like protein; Dipeptidyl peptidase VI; DPP VI
Target Background
This gene encodes a single-pass type II membrane protein that is a member of the peptidase S9B family of serine proteases. This protein has no detectable protease activity, most likely due to the absence of the conserved serine residue normally present in the catalytic domain of serine proteases. However, it does bind specific voltage-gated potassium channels and alters their expression and biophysical properties. Variations in this gene may be associated with susceptibility to amyotrophic lateral sclerosis and with idiopathic ventricular fibrillation. Alternative splicing results in multiple transcript variants.
Notification