-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DR4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 124-232 of human DR4 (NP_003835.3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on FC, ELISA.
The antibody against DR4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 124-232 of human DR4 (NP_003835.3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on FC, ELISA.
| Cat.No | ADA-15576A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DR4 |
| Target Synonyms | TNFRSF10A; APO2; CD261; DR4; TRAILR-1; TRAILR1; TNF receptor superfamily member 10a | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, FC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 124-232 of human DR4 (NP_003835.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EHSPLGELCPPGSHRSEHPGACNRCTEGVGYTNASNNLFACLPCTACKSDEEERSPCTTTRNTACQCKPGTFRNDNSAEMCRKCSRGCPRGMVKVKDCTPWSDIECVHK | Uniprot ID | O00220 |
Uniprot Id
O00220
Target Species
Human
Target Name
TNFRSF10A
Target Full Name
Tumor necrosis factor receptor superfamily member 10A
Target Function
Receptor for the cytotoxic ligand TNFSF10/TRAIL. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. Promotes the activation of NF-kappa-B.
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein. Membrane raft. Cytoplasm, cytosol.
Target Tissue Specificity
Widely expressed. High levels are found in spleen, peripheral blood leukocytes, small intestine and thymus, but also in K-562 erythroleukemia cells, MCF-7 breast carcinoma cells and activated T-cells.
Target Synonyms
TNFRSF10A; APO2; DR4; TRAILR1; Tumor necrosis factor receptor superfamily member 10A; Death receptor 4; TNF-related apoptosis-inducing ligand receptor 1; TRAIL receptor 1; TRAIL-R1; CD antigen CD261
Target Background
The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is activated by tumor necrosis factor-related apoptosis inducing ligand (TNFSF10/TRAIL), and thus transduces cell death signal and induces cell apoptosis. Studies with FADD-deficient mice suggested that FADD, a death domain containing adaptor protein, is required for the apoptosis mediated by this protein.
Notification