-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DUSP9 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human DUSP9 (NP_001386.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against DUSP9 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human DUSP9 (NP_001386.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-00469A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DUSP9 |
| Target Synonyms | MKP4; MKP-4; DUSP9 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, HepG2, Mouse liver | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human DUSP9 (NP_001386.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MEGLGRSCLWLRRELSPPRPRLLLLDCRSRELYESARIGGALSVALPALLLRRLRRGSLSVRALLPGPPLQPPPPAPVLLYDQGGGRRRRGEAEAEAEEWEAESVLGTLLQKLREEGYLAYYLQGGFSRFQAECPHLCETSLAGRAGSSMAPVPGPVPVVGLGSLCLGSDCSDAESEADRDSMSCGLDSEGATPPPVGLR | Uniprot ID | Q99956 |
Uniprot Id
Q99956
Target Species
Human
Target Name
DUSP9
Target Full Name
Dual specificity protein phosphatase 9
Target Function
Inactivates MAP kinases. Has a specificity for the ERK family.
Target Subcellular Location
Cytoplasm.
Target Protein Families
Protein-tyrosine phosphatase family, Non-receptor class dual specificity subfamily
Target Synonyms
Dual specificity phosphatase 9; Dual specificity protein phosphatase 9; DUS9_HUMAN; DUSP9; MAP kinase phosphatase 4; Mitogen activated protein kinase phosphatase 4; Mitogen-activated protein kinase phosphatase 4; MKP 4; MKP-4; MKP4; serine/threonine specific protein phosphatase
Target Background
The protein encoded by this gene is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regulate members of the mitogen-activated protein (MAP) kinase superfamily (MAPK/ERK, SAPK/JNK, p38), which is associated with cellular proliferation and differentiation. Different members of the family of dual specificity phosphatases show distinct substrate specificities for various MAP kinases, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli. This gene product shows selectivity for members of the ERK family of MAP kinases and is localized to the cytoplasm and nucleus. Aberrant expression of this gene is associated with type 2 diabetes and cancer progression in several cell types. Alternate splicing results in multiple transcript variants.
Notification