Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DYRK4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 330-480 of human DYRK4 (NP_003836.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against DYRK4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 330-480 of human DYRK4 (NP_003836.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00265A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DYRK4 |
| Target Synonyms | DYRK4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, A-549, C2C12, HepG2, Jurkat, Rat testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 330-480 of human DYRK4 (NP_003836.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TASRRQTFFDSKGFPKNITNNRGKKRYPDSKDLTMVLKTYDTSFLDFLRRCLVWEPSLRMTPDQALKHAWIHQSRNLKPQPRPQTLRKSNSFFPSETRKDKVQGCHHSSRKADEITKETTEKTKDSPTKHVQHSGDQQDCLQHGADTVQLP | Uniprot ID | Q9NR20 |
Uniprot Id
Q9NR20
Target Species
Human
Target Name
DYRK4
Target Full Name
Dual specificity tyrosine-phosphorylation-regulated kinase 4
Target Function
Possible non-essential role in spermiogenesis.
Target Subcellular Location
[Isoform 1]: Cytoplasm.; [Isoform 4]: Cytoplasm. Nucleus.
Target Protein Families
Protein kinase superfamily, CMGC Ser/Thr protein kinase family, MNB/DYRK subfamily
Target Synonyms
DYRK4Dual specificity tyrosine-phosphorylation-regulated kinase 4; EC 2.7.12.1
Target Background
This gene encodes an enzyme that belongs to a conserved family of serine/threonine protein kinases. Members of this dual specificity kinase family are thought to function in the regulation of cell differentiation and proliferation, survival, and in development. Alternate splicing results in multiple transcript variants. Additional alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
