Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against EIF1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-113 of human EIF1 (NP_005792.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against EIF1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-113 of human EIF1 (NP_005792.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01691A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | EIF1 |
| Target Synonyms | A121; ISO1; SUI1; EIF-1; EIF1A; EIF1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, Mouse liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-113 of human EIF1 (NP_005792.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSAIQNLHSFDPFADASKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLVEIGLAKDDQLKVHGF | Uniprot ID | P41567 |
Uniprot Id
P41567
Target Species
Human
Target Name
EIF1
Target Full Name
Eukaryotic translation initiation factor 1
Target Function
Necessary for scanning and involved in initiation site selection. Promotes the assembly of 48S ribosomal complexes at the authentic initiation codon of a conventional capped mRNA.
Target Protein Families
SUI1 family
Target Research Area
Metabolism
Target Synonyms
EIF1; SUI1Eukaryotic translation initiation factor 1; eIF1; A121; Protein translation factor SUI1 homolog; Sui1iso1
Target Background
Enables RNA binding activity. Involved in regulation of translational initiation. Located in cytoplasm and nucleus.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
