-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ERAP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human ERAP2 (NP_071745.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ERAP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human ERAP2 (NP_071745.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01060A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ERAP2 |
| Target Synonyms | LRAP; L-RAP; ERAP2 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, A375 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human ERAP2 (NP_071745.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MFHSSAMVNSHRKPMFNIHRGFYCLTAILPQICICSQFSVPSSYHFTEDPGAFPVATNGERFPWQELRLPSVVIPLHYDLFVHPNLTSLDFVASEKIEVLVSNATQFIILHSKDLEITNATLQSEEDSRYMKPGKELKVLSYPAHEQIALLVPEKLTPHLKYYVAMDFQA | Uniprot ID | Q6P179 |
Uniprot Id
Q6P179
Target Species
Human
Target Name
ERAP2
Target Full Name
Endoplasmic reticulum aminopeptidase 2
Target Function
Aminopeptidase that plays a central role in peptide trimming, a step required for the generation of most HLA class I-binding peptides. Peptide trimming is essential to customize longer precursor peptides to fit them to the correct length required for presentation on MHC class I molecules. Preferentially hydrolyzes the basic residues Arg and Lys.
Target Subcellular Location
Endoplasmic reticulum membrane; Single-pass type II membrane protein.
Target Protein Families
Peptidase M1 family
Target Tissue Specificity
Ubiquitously expressed. Highly expressed in spleen and leukocytes.
Target Synonyms
ERAP2; LRAPEndoplasmic reticulum aminopeptidase 2; EC 3.4.11.-; Leukocyte-derived arginine aminopeptidase; L-RAP
Target Background
This gene encodes a zinc metalloaminopeptidase of the M1 protease family that resides in the endoplasmic reticulum and functions in N-terminal trimming antigenic epitopes for presentation by major histocompatibility complex (MHC) class I molecules. Certain mutations in this gene are associated with the inflammatory arthritis syndrome ankylosing spondylitis and pre-eclampsia. This gene is located adjacent to a closely related aminopeptidase gene on chromosome 5.
Notification