-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ErbB3/HER3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1275-1342 of human ErbB3/HER3 (NP_001973.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against ErbB3/HER3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1275-1342 of human ErbB3/HER3 (NP_001973.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-13289A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ErbB3/HER3 |
| Target Synonyms | HER3; FERLK; LCCS2; VSCN1; ErbB-3; c-erbB3; erbB3-S; MDA-BF-1; c-erbB-3; p180-ErbB3; p45-sErbB3; p85-sErbB3; R3 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, A-431, MCF7, Mouse liver | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1275-1342 of human ErbB3/HER3 (NP_001973.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DYAAMGACPASEQGYEEMRAFQGPGHQAPHVHYARLKTLRSLEATDSAFDNPDYWHSRLFPKANAQRT | Uniprot ID | P21860 |
Uniprot Id
P21860
Target Species
Human
Target Name
ERBB3
Target Full Name
Receptor tyrosine-protein kinase erbB-3
Target Function
Tyrosine-protein kinase that plays an essential role as cell surface receptor for neuregulins. Binds to neuregulin-1 (NRG1) and is activated by it; ligand-binding increases phosphorylation on tyrosine residues and promotes its association with the p85 subunit of phosphatidylinositol 3-kinase. May also be activated by CSPG5. Involved in the regulation of myeloid cell differentiation.
Target Involvement
Lethal congenital contracture syndrome 2 (LCCS2)
Target Subcellular Location
[Isoform 1]: Cell membrane; Single-pass type I membrane protein.; [Isoform 2]: Secreted.
Target Protein Families
Protein kinase superfamily, Tyr protein kinase family, EGF receptor subfamily
Target Tissue Specificity
Epithelial tissues and brain.
Target Synonyms
c erbB 3; c erbB3; Erb b2 receptor tyrosine kinase 3; ErbB 3; ERBB3; ERBB3 protein; erbB3 S; ERBB3_HUMAN; Glial growth factor receptor; HER 3; HER3; Human epidermal growth factor receptor 3; LCCS2; MDA BF 1; MGC88033; p180 ErbB3; p45 sErbB3; p85 sErbB3; proto-oncogene-like protein c ErbB 3; proto-oncogene-like protein c ErbB3; Proto-oncogene-like protein c-ErbB-3; Receptor tyrosine protein kinase erbB 3; Receptor tyrosine protein kinase erbB3; Receptor tyrosine-protein kinase erbB-3; Tyrosine kinase type cell surface receptor HER3; Tyrosine kinase-type cell surface receptor HER3; v erb b2 avian erythroblastic leukemia viral oncogene homolog 3; v erb b2 erythroblastic leukemia viral oncogene homolog 3 (avian); v erb b2 erythroblastic leukemia viral oncogene homolog 3
Target Background
This gene encodes a member of the epidermal growth factor receptor (EGFR) family of receptor tyrosine kinases. This membrane-bound protein has a neuregulin binding domain but not an active kinase domain. It therefore can bind this ligand but not convey the signal into the cell through protein phosphorylation. However, it does form heterodimers with other EGF receptor family members which do have kinase activity. Heterodimerization leads to the activation of pathways which lead to cell proliferation or differentiation. Amplification of this gene and/or overexpression of its protein have been reported in numerous cancers, including prostate, bladder, and breast tumors. Alternate transcriptional splice variants encoding different isoforms have been characterized. One isoform lacks the intermembrane region and is secreted outside the cell. This form acts to modulate the activity of the membrane-bound form. Additional splice variants have also been reported, but they have not been thoroughly characterized.
Notification