-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ETFB was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 80-230 of human ETFB (NP_001976.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against ETFB was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 80-230 of human ETFB (NP_001976.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-04675A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ETFB |
| Target Synonyms | MADD; FP585; ETFB | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse kidney, 293T, A-549, BxPC-3, Mouse brain, Mouse liver, U-87MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 80-230 of human ETFB (NP_001976.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AMGADRGIHVEVPPAEAERLGPLQVARVLAKLAEKEKVDLVLLGKQAIDDDCNQTGQMTAGFLDWPQGTFASQVTLEGDKLKVEREIDGGLETLRLKLPAVVTADLRLNEPRYATLPNIMKAKKKKIEVIKPGDLGVDLTSKLSVISVEDP | Uniprot ID | P38117 |
Uniprot Id
P38117
Target Species
Human
Target Name
ETFB
Target Full Name
Electron transfer flavoprotein subunit beta
Target Function
Heterodimeric electron transfer flavoprotein that accepts electrons from several mitochondrial dehydrogenases, including acyl-CoA dehydrogenases, glutaryl-CoA and sarcosine dehydrogenase. It transfers the electrons to the main mitochondrial respiratory chain via ETF-ubiquinone oxidoreductase (Probable). Required for normal mitochondrial fatty acid oxidation and normal amino acid metabolism. ETFB binds an AMP molecule that probably has a purely structural role.
Target Involvement
Glutaric aciduria 2B (GA2B)
Target Subcellular Location
Mitochondrion matrix.
Target Protein Families
ETF beta-subunit/FixA family
Target Tissue Specificity
Abundant in liver, heart and skeletal muscle. A weak expression is seen in the brain, placenta, lung, kidney and pancreas.
Target Synonyms
Beta ETF; Beta-ETF; Electron transfer flavoprotein beta polypeptide ; Electron transfer flavoprotein beta subunit ; Electron transfer flavoprotein subunit beta; Electron transferring flavoprotein beta polypeptide ; etfB; ETFB_HUMAN; FP585; MADD
Target Background
This gene encodes electron-transfer-flavoprotein, beta polypeptide, which shuttles electrons between primary flavoprotein dehydrogenases involved in mitochondrial fatty acid and amino acid catabolism and the membrane-bound electron transfer flavoprotein ubiquinone oxidoreductase. The gene deficiencies have been implicated in type II glutaricaciduria. Alternatively spliced transcript variants have been found for this gene.
Notification