-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FAR1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human FAR1 (NP_115604.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against FAR1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human FAR1 (NP_115604.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06674A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FAR1 |
| Target Synonyms | CSPSD; PFCRD; MLSTD2; SDR10E1; FAR1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Daudi, HepG2(Negative control) | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human FAR1 (NP_115604.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MVSIPEYYEGKNVLLTGATGFLGKVLLEKLLRSCPKVNSVYVLVRQKAGQTPQERVEEVLSGKLFDRLRDENPDFREKIIAINSELTQPKLALSEEDKEV | Uniprot ID | Q8WVX9 |
Uniprot Id
Q8WVX9
Target Species
Human
Target Name
FAR1
Target Full Name
Fatty acyl-CoA reductase 1
Target Function
Catalyzes the reduction of saturated and unsaturated C16 or C18 fatty acyl-CoA to fatty alcohols. It plays an essential role in the production of ether lipids/plasmalogens which synthesis requires fatty alcohols. In parallel, it is also required for wax monoesters production since fatty alcohols also constitute a substrate for their synthesis.
Target Involvement
Peroxisomal fatty acyl-CoA reductase 1 disorder (PFCRD)
Target Subcellular Location
Peroxisome membrane; Single-pass membrane protein.
Target Protein Families
Fatty acyl-CoA reductase family
Target Synonyms
FAR1; MLSTD2; UNQ2423/PRO4981; Fatty acyl-CoA reductase 1; Male sterility domain-containing protein 2
Target Background
The protein encoded by this gene is required for the reduction of fatty acids to fatty alcohols, a process that is required for the synthesis of monoesters and ether lipids. NADPH is required as a cofactor in this reaction, and 16-18 carbon saturated and unsaturated fatty acids are the preferred substrate. This is a peroxisomal membrane protein, and studies suggest that the N-terminus contains a large catalytic domain located on the outside of the peroxisome, while the C-terminus is exposed to the matrix of the peroxisome. Studies indicate that the regulation of this protein is dependent on plasmalogen levels. Mutations in this gene have been associated with individuals affected by severe intellectual disability, early-onset epilepsy, microcephaly, congenital cataracts, growth retardation, and spasticity (PMID: 25439727). A pseudogene of this gene is located on chromosome 13.
Notification