-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FBXL2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 120-240 of human FBXL2 (NP_036289.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against FBXL2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 120-240 of human FBXL2 (NP_036289.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01398A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FBXL2 |
| Target Synonyms | FBL2; FBL3; FBXL2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat brain, A-549, HT-1080, Mouse brain, Rat kidney, SKOV3, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 120-240 of human FBXL2 (NP_036289.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | STCYSLSRFCSKLKHLDLTSCVSITNSSLKGISEGCRNLEYLNLSWCDQITKDGIEALVRGCRGLKALLLRGCTQLEDEALKHIQNYCHELVSLNLQSCSRITDEGVVQICRGCHRLQALC | Uniprot ID | Q9UKC9 |
Uniprot Id
Q9UKC9
Target Species
Human
Target Name
FBXL2
Target Full Name
F-box/LRR-repeat protein 2
Target Function
Calcium-activated substrate recognition component of the SCF (SKP1-cullin-F-box protein) E3 ubiquitin-protein ligase complex, SCF(FBXL2), which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Unlike many F-box proteins, FBXL2 does not seem to target phosphodegron within its substrates but rather calmodulin-binding motifs and is thereby antagonized by calmodulin. This is the case for the cyclins CCND2 and CCND3 which polyubiquitination and subsequent degradation are inhibited by calmodulin. Through CCND2 and CCND3 degradation induces cell-cycle arrest in G(0). SCF(FBXL2) also mediates PIK3R2 ubiquitination and proteasomal degradation thereby regulating phosphatidylinositol 3-kinase signaling and autophagy. PCYT1A monoubiquitination by SCF(FBXL2) and subsequent degradation regulates synthesis of phosphatidylcholine, which is utilized for formation of membranes and of pulmonary surfactant.
Target Subcellular Location
Membrane; Lipid-anchor.
Target Tissue Specificity
Expressed in brain, heart, kidney, liver, lung, pancreas and placenta.
Target Research Area
Cell Biology, Epigenetics and Nuclear Signaling
Target Synonyms
DKFZP564P0622; F box and leucine rich repeat protein 2; F box protein containing leucine rich repeats; F box protein FBL2/FBL3; F box/LRR repeat protein 2; F-box and leucine-rich repeat protein 2; F-box protein FBL2/FBL3; F-box/LRR-repeat protein 2; FBL 2; FBL 3; FBL2; FBL3; FBXL 2; FBXL2; FBXL2_HUMAN
Target Background
This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbls class and, in addition to an F-box, contains 12 tandem leucine-rich repeats. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Notification