-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FBXO25 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 142-291 of human FBXO25 (NP_036305.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against FBXO25 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 142-291 of human FBXO25 (NP_036305.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05241A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FBXO25 |
| Target Synonyms | FBX25; FBXO25 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, DU145, Mouse testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 142-291 of human FBXO25 (NP_036305.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | WQQQLQDLQMTKQVNNGLTLSDLPLHMLNNILYRFSDGWDIITLGQVTPTLYMLSEDRQLWKKLCQYHFAEKQFCRHLILSEKGHIEWKLMYFALQKHYPAKEQYGDTLHFCRHCSILFWKDSGHPCTAADPDSCFTPVSPQHFIDLFKF | Uniprot ID | Q8TCJ0 |
Uniprot Id
Q8TCJ0
Target Species
Human
Target Name
FBXO25
Target Full Name
F-box only protein 25
Target Function
Substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex. May play a role in accumulation of expanded polyglutamine (polyQ) protein huntingtin (HTT).
Target Involvement
A chromosomal aberration involving FBXO25 is a cause of X-linked mental retardation (XLMR). Translocation t(X;8)(p11.22;p23.3) with SHROOM4.
Target Subcellular Location
Nucleus. Note=In the nucleus, associates with a subnuclear dot-like structure. Colocalized with SKP1.
Target Tissue Specificity
Expressed in all brain tissue observed.
Target Synonyms
F box only protein 25; F box protein 25; F box protein Fbx25; F-box only protein 25; FBX25 ; FBX25_HUMAN; FBXO25; MGC20256; MGC51975; OTTHUMP00000115399
Target Background
This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class. Three alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Notification