Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FCGR1B was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human FCGR1B (NP_001017986.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against FCGR1B was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human FCGR1B (NP_001017986.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
Immunohistochemistry analysis of FCGR1B in paraffin-embedded human lung cancer using FCGR1B Rabbit pAb at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
| Cat.No | ADA-06889A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FCGR1B |
| Target Synonyms | CD34; FCG1; FcRI; CD64b; FCGR1; IGFR1; IGFRB; FCGR1B; FcgammaRIa | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse plasma | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human FCGR1B (NP_001017986.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | IHRGWLLLQVSSRVFMEGEPLALRCHAWKDKLVYNVLYYRNGKAFKFFHWNSNLTILKTNISHNGTYHCSGMGKHRYTSAGISQYTVKGLQLPTPVWFHVL | Uniprot ID | Q92637 |
Uniprot Id
Q92637
Target Species
Human
Target Name
FCGR1BP
Target Full Name
Putative high affinity immunoglobulin gamma Fc receptor IB
Target Function
May bind to the Fc region of immunoglobulins gamma with a low affinity compared to FCGR1A. May function in the humoral immune response.
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Target Protein Families
Immunoglobulin superfamily, FCGR1 family
Target Synonyms
FCGR1B; IGFRBHigh affinity immunoglobulin gamma Fc receptor IB; IgG Fc receptor IB; Fc-gamma RIB; FcRIB; hFcgammaRIB
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
