-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FGF12 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-181 of human FGF12 (NP_004104.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against FGF12 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-181 of human FGF12 (NP_004104.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-04308A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FGF12 |
| Target Synonyms | FHF1; DEE47; EIEE47; FGF12B; FGF12 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-181 of human FGF12 (NP_004104.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MESKEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREPSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST | Uniprot ID | P61328 |
Uniprot Id
P61328
Target Species
Human
Target Name
FGF12
Target Full Name
Fibroblast growth factor 12
Target Function
Involved in nervous system development and function. Involved in the positive regulation of voltage-gated sodium channel activity. Promotes neuronal excitability by elevating the voltage dependence of neuronal sodium channel SCN8A fast inactivation.
Target Involvement
Epileptic encephalopathy, early infantile, 47 (EIEE47)
Target Subcellular Location
Nucleus.
Target Protein Families
Heparin-binding growth factors family
Target Tissue Specificity
Brain, eye and testis; highly expressed in embryonic retina, olfactory epithelium, olfactory bulb, and in a segmental pattern of the body wall; in adult olfactory bulb, less in cerebellum, deep cerebellar nuclei, cortex and multiple midbrain structures.
Target Research Area
Cardiovascular
Target Synonyms
EIEE47; FGF-12; Fgf12; FGF12_HUMAN; FGF12B; FHF-1; FHF1; Fibroblast growth factor 12; Fibroblast growth factor 12B; Fibroblast growth factor FGF 12b; Fibroblast growth factor homologous factor 1; Myocyte activating factor; Myocyte-activating factor
Target Background
The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth, and invasion. This growth factor lacks the N-terminal signal sequence present in most of the FGF family members, but it contains clusters of basic residues that have been demonstrated to act as a nuclear localization signal. When transfected into mammalian cells, this protein accumulated in the nucleus, but was not secreted. The specific function of this gene has not yet been determined.
Notification