-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FIP200 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1280-1400 of human FIP200 (NP_055596.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against FIP200 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1280-1400 of human FIP200 (NP_055596.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-12183A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FIP200 |
| Target Synonyms | CC1; ATG17; FIP200; PPP1R131 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse testis, Rat testis, U2OS | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1280-1400 of human FIP200 (NP_055596.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TRGDSSSLVAELQEKLQEEKAKFLEQLEEQEKRKNEEMQNVRTSLIAEQQTNFNTVLTREKMRKENIINDLSDKLKSTMQQQERDKDLIESLSEDRARLLEEKKKLEEEVSKLRSSSFVPS | Uniprot ID | Q8TDY2 |
Uniprot Id
Q8TDY2
Target Species
Human
Target Name
RB1CC1
Target Full Name
RB1-inducible coiled-coil protein 1
Target Function
Involved in autophagy. Regulates early events but also late events of autophagosome formation through direct interaction with Atg16L1. Required for the formation of the autophagosome-like double-membrane structure that surrounds the Salmonella-containing vacuole (SCV) during S.typhimurium infection and subsequent xenophagy. Involved in repair of DNA damage caused by ionizing radiation, which subsequently improves cell survival by decreasing apoptosis. Inhibits PTK2/FAK1 and PTK2B/PYK2 kinase activity, affecting their downstream signaling pathways. Plays a role as a modulator of TGF-beta-signaling by restricting substrate specificity of RNF111. Functions as a DNA-binding transcription factor. Is a potent regulator of the RB1 pathway through induction of RB1 expression. Plays a crucial role in muscular differentiation. Plays an indispensable role in fetal hematopoiesis and in the regulation of neuronal homeostasis.
Target Subcellular Location
Nucleus. Cytoplasm. Cytoplasm, cytosol. Preautophagosomal structure. Lysosome.
Target Protein Families
ATG17 family
Target Tissue Specificity
Expression levels correlated closely with those of RB1 in cancer cell lines as well as in various normal human tissues. Abundantly expressed in human musculoskeletal and cultured osteosarcoma cells.
Target Research Area
Others
Target Synonyms
FAK family kinase-interacting protein of 200 kDa; FIP200; RB1-inducible coiled-coil protein 1; RB1CC1; RBCC1_HUMAN
Target Background
The protein encoded by this gene interacts with signaling pathways to coordinately regulate cell growth, cell proliferation, apoptosis, autophagy, and cell migration. This tumor suppressor also enhances retinoblastoma 1 gene expression in cancer cells. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Notification