Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FNTB was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human FNTB (NP_002019.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against FNTB was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human FNTB (NP_002019.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04912A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FNTB |
| Target Synonyms | FPTB; FNTB | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, 293T, HepG2, K-562, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human FNTB (NP_002019.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MASPSSFTYYCPPSSSPVWSEPLYSLRPEHARERLQDDSVETVTSIEQAKVEEKIQEVFSSYKFNHLVPRLVLQREKHFHYLKRGLRQLTDAYECLDASRPWLCYWILHSLELLDEPIPQ | Uniprot ID | P49356 |
Uniprot Id
P49356
Target Species
Human
Target Name
FNTB
Target Full Name
Protein farnesyltransferase subunit beta
Target Function
Essential subunit of the farnesyltransferase complex. Catalyzes the transfer of a farnesyl moiety from farnesyl diphosphate to a cysteine at the fourth position from the C-terminus of several proteins having the C-terminal sequence Cys-aliphatic-aliphatic-X.
Target Protein Families
Protein prenyltransferase subunit beta family
Target Synonyms
CAAX farnesyltransferase subunit beta; EC 2.5.1.58; EC=2.5.1.58; Farnesyltransferase; farnesyltransferase CAAX box beta1; farnesyltransferase; CAAX box; beta; FNTB; FNTB_HUMAN; FPTB; FTase beta; FTase-beta; MGC105303; Protein farnesyltransferase subunit beta; RAS proteins prenyltransferase beta ; Ras proteins prenyltransferase subunit beta
Target Background
Enables zinc ion binding activity. Contributes to protein farnesyltransferase activity. Involved in protein farnesylation. Part of microtubule associated complex and protein farnesyltransferase complex.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
