Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FOSL1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human FOSL1 (NP_005429.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against FOSL1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human FOSL1 (NP_005429.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07927A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FOSL1 |
| Target Synonyms | FRA; FRA1; fra-1; L1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | U-87 MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human FOSL1 (NP_005429.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MFRDFGEPGPSSGNGGGYGGPAQPPAAAQAAQQKFHLVPSINTMSGSQELQWMVQPHFLGPSSYPRPLTYPQYSPPQPRPGVIRALGPPPGVRRRPCEQI | Uniprot ID | P15407 |
Uniprot Id
P15407
Target Species
Human
Target Name
FOSL1
Target Full Name
Fos-related antigen 1
Target Subcellular Location
Nucleus.
Target Protein Families
BZIP family, Fos subfamily
Target Synonyms
FOS L1; FOS like antigen 1; Fos related antigen 1; Fos-related antigen 1; FOSL 1; FOSL1; FOSL1 protein; FOSL1_HUMAN; FRA 1; FRA-1
Target Background
The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation. Several transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
