Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FOXQ1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human FOXQ1 (NP_150285.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.
The antibody against FOXQ1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human FOXQ1 (NP_150285.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.
Immunohistochemistry analysis of paraffin-embedded human cervical using FOXQ1 Rabbit pAb at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
| Cat.No | ADA-08205A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FOXQ1 |
| Target Synonyms | FOXQ1; HFH1; forkhead box Q1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human FOXQ1 (NP_150285.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MKLEVFVPRAAHGDKQGSDLEGAGGSDAPSPLSAAGDDSLGSDGDCAANSPAAGGGARDTQGDGEQSAGGGPGAEEAIPAAAAAAVVAEGAEAGAAGPGA | Uniprot ID | Q9C009 |
Uniprot Id
Q9C009
Target Species
Human
Target Name
FOXQ1
Target Full Name
Forkhead box protein Q1
Target Function
Plays a role in hair follicle differentiation.
Target Subcellular Location
Nucleus.
Target Tissue Specificity
Expressed predominantly in the stomach, trachea, bladder and salivary gland.
Target Synonyms
Forkhead box protein Q1; Forkhead box Q1; FOX Q1; FOXQ 1; FOXQ1; FOXQ1_HUMAN; Hepatocyte nuclear factor 3 forkhead; Hepatocyte nuclear factor 3 forkhead homolog 1; HFH 1; HFH-1; HFH1; HNF 3/forkhead like protein 1; HNF-3/forkhead-like protein 1; HNF3/forkhead like protein 1; MGC77469; Q1; Winged helix / forkhead transcription factor; Winged helix/forkhead transcription factor; zgc:77469
Target Background
FOXQ1 is a member of the FOX gene family, which is characterized by a conserved 110-amino acid DNA-binding motif called the forkhead or winged helix domain. FOX genes are involved in embryonic development, cell cycle regulation, tissue-specific gene expression, cell signaling, and tumorigenesis (Bieller et al., 2001 [PubMed 11747606]).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
