Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FXR1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human FXR1 (P51114) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against FXR1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human FXR1 (P51114) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-13965A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FXR1 |
| Target Synonyms | FXR1P; CMYP9A; CMYP9B; MYOPMIL; MYORIBF; FXR1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | NIH/3T3, 293T, Hep G2, U-251MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human FXR1 (P51114). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAELTVEVRGSNGAFYKGFIKDVHEDSLTVVFENNWQPERQVPFNEVRLPPPPDIKKEISEGDEVEVYSRANDQEPCGWWLAKVRMMKGEFYVIEYAACD | Uniprot ID | P51114 |
Uniprot Id
P51114
Target Species
Human
Target Name
FXR1
Target Full Name
RNA-binding protein FXR1
Target Function
RNA-binding protein required for embryonic and postnatal development of muscle tissue. May regulate intracellular transport and local translation of certain mRNAs.
Target Subcellular Location
Cytoplasm, cytosol.
Target Protein Families
FMR1 family
Target Tissue Specificity
Expressed in all tissues examined including heart, brain, kidney and testis.
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
Fragile X mental retardation autosomal homolog 1; Fragile X mental retardation syndrome related protein 1; Fragile X mental retardation syndrome-related protein 1; FXR1; FXR1_HUMAN; FXR1P; hFXR1p
Target Background
The protein encoded by this gene is an RNA binding protein that interacts with the functionally-similar proteins FMR1 and FXR2. These proteins shuttle between the nucleus and cytoplasm and associate with polyribosomes, predominantly with the 60S ribosomal subunit. Three transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
