-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GABRG2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 400-500 of human GABRG2 (NP_944493.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GABRG2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 400-500 of human GABRG2 (NP_944493.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11893A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GABRG2 |
| Target Synonyms | CAE2; ECA2; FEB8; DEE74; EIEE74; GEFSP3; GABRG2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 400-500 of human GABRG2 (NP_944493.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VSNRKPSKDKDKKKKNPLLRMFSFKAPTIDIRPRSATIQMNNATHLQERDEEYGYECLDGKDCASFFCCFEDCRTGAWRHGRIHIRIAKMDSYARIFFPTA | Uniprot ID | P18507 |
Uniprot Id
P18507
Target Species
Human
Target Name
GABRG2
Target Full Name
Gamma-aminobutyric acid receptor subunit gamma-2
Target Function
Ligand-gated chloride channel which is a component of the heteropentameric receptor for GABA, the major inhibitory neurotransmitter in the brain. Plays an important role in the formation of functional inhibitory GABAergic synapses in addition to mediating synaptic inhibition as a GABA-gated ion channel. The gamma2 subunit is necessary but not sufficient for a rapid formation of active synaptic contacts and the synaptogenic effect of this subunit is influenced by the type of alpha and beta subunits present in the receptor pentamer. The alpha1/beta2/gamma2 receptor and the alpha1/beta3/gamma2 receptor exhibit synaptogenic activity. The alpha2/beta2/gamma2 receptor exhibits synatogenic activity whereas the alpha2/beta3/gamma2 receptor shows very little or no synaptogenic activity. Functions also as histamine receptor and mediates cellular responses to histamine.
Target Involvement
Epilepsy, childhood absence 2 (ECA2); Febrile seizures, familial, 8 (FEB8); Generalized epilepsy with febrile seizures plus 3 (GEFS+3)
Target Subcellular Location
Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Cell projection, dendrite. Cytoplasmic vesicle membrane.
Target Protein Families
Ligand-gated ion channel (TC 1.A.9) family, Gamma-aminobutyric acid receptor (TC 1.A.9.5) subfamily, GABRG2 sub-subfamily
Target Synonyms
CAE 2; CAE2; ECA 2; ECA2; GABA(A) receptor gamma 2; GABA(A) receptor subunit gamma 2; GABA(A) receptor subunit gamma-2; GABRG 2; GABRG2; Gamma aminobutyric acid (GABA) A receptor gamma 2; Gamma aminobutyric acid A receptor gamma 2; Gamma aminobutyric acid receptor gamma 2 subunit ; Gamma-aminobutyric acid receptor subunit gamma-2; GBRG2_HUMAN; GEFSP 3; GEFSP3
Target Background
This gene encodes a gamma-aminobutyric acid (GABA) receptor. GABA is the major inhibitory neurotransmitter in the mammlian brain, where it acts at GABA-A receptors, which are ligand-gated chloride channels. GABA-A receptors are pentameric, consisting of proteins from several subunit classes: alpha, beta, gamma, delta and rho. Mutations in this gene have been associated with epilepsy and febrile seizures. Multiple transcript variants encoding different isoforms have been identified for this gene.
Notification