Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GADD45A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-165 of human GADD45A (NP_001915.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GADD45A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-165 of human GADD45A (NP_001915.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06216A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GADD45A |
| Target Synonyms | DDIT1; GADD45; GADD45A | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-165 of human GADD45A (NP_001915.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLAADEDDDRDVALQIHFTLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER | Uniprot ID | P24522 |
Uniprot Id
P24522
Target Species
Human
Target Name
GADD45A
Target Full Name
Growth arrest and DNA damage-inducible protein GADD45 alpha
Target Function
In T-cells, functions as a regulator of p38 MAPKs by inhibiting p88 phosphorylation and activity. Might affect PCNA interaction with some CDK (cell division protein kinase) complexes; stimulates DNA excision repair in vitro and inhibits entry of cells into S phase.
Target Subcellular Location
Nucleus.
Target Protein Families
GADD45 family
Target Research Area
Cell Cycle
Target Synonyms
DDIT 1; DDIT-1; DDIT1; DNA damage inducible transcript 1; DNA damage-inducible transcript 1 protein; GA45A_HUMAN; GADD45; GADD45A; Growth arrest and DNA damage inducible 45 alpha ; Growth arrest and DNA damage inducible alpha; Growth arrest and DNA damage-inducible protein GADD45 alpha
Target Background
This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The protein encoded by this gene responds to environmental stresses by mediating activation of the p38/JNK pathway via MTK1/MEKK4 kinase. The DNA damage-induced transcription of this gene is mediated by both p53-dependent and -independent mechanisms. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
