-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GCH1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 55-250 of human GCH1 (NP_000152.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against GCH1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 55-250 of human GCH1 (NP_000152.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-10934A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GCH1 |
| Target Synonyms | GCH; DYT5; DYT14; DYT5a; GTPCH1; HPABH4B; GTP-CH-1; GCH1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver, Rat liver | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 55-250 of human GCH1 (NP_000152.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GERPRSEEDNELNLPNLAAAYSSILSSLGENPQRQGLLKTPWRAASAMQFFTKGYQETISDVLNDAIFDEDHDEMVIVKDIDMFSMCEHHLVPFVGKVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQERLTKQIAVAITEALRPAGVGVVVEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTREEFLTLIRS | Uniprot ID | P30793 |
Uniprot Id
P30793
Target Species
Human
Target Name
GCH1
Target Full Name
GTP cyclohydrolase 1
Target Function
Positively regulates nitric oxide synthesis in umbilical vein endothelial cells (HUVECs). May be involved in dopamine synthesis. May modify pain sensitivity and persistence. Isoform GCH-1 is the functional enzyme, the potential function of the enzymatically inactive isoforms remains unknown.
Target Involvement
Hyperphenylalaninemia, BH4-deficient, B (HPABH4B); Dystonia, dopa-responsive (DRD)
Target Subcellular Location
Cytoplasm. Nucleus.
Target Protein Families
GTP cyclohydrolase I family
Target Tissue Specificity
In epidermis, expressed predominantly in basal undifferentiated keratinocytes and in some but not all melanocytes (at protein level).
Target Synonyms
dystonia 14; DYT 5; DYT14; DYT5; DYT5a; GCH 1; GCH; Gch1; GCH1_HUMAN; GTP CH 1; GTP CH I ; GTP cyclohydrolase 1 (dopa responsive dystonia); GTP cyclohydrolase 1; GTP cyclohydrolase I; GTP-CH-I; GTPCH 1; GTPCH1; Guanosine 5' triphosphate cyclohydrolase I; HPABH4B
Target Background
This gene encodes a member of the GTP cyclohydrolase family. The encoded protein is the first and rate-limiting enzyme in tetrahydrobiopterin (BH4) biosynthesis, catalyzing the conversion of GTP into 7, 8-dihydroneopterin triphosphate. BH4 is an essential cofactor required by aromatic amino acid hydroxylases as well as nitric oxide synthases. Mutations in this gene are associated with malignant hyperphenylalaninemia and dopa-responsive dystonia. Several alternatively spliced transcript variants encoding different isoforms have been described; however, not all variants give rise to a functional enzyme.
Notification