Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GDF-8/Myostatin was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 267-375 of human GDF-8/Myostatin (NP_005250.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against GDF-8/Myostatin was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 267-375 of human GDF-8/Myostatin (NP_005250.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
Western blot analysis of HeLa, using GDF-8/Myostatin Rabbit pAb at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 60s.
| Cat.No | ADA-12443A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GDF-8/Myostatin |
| Target Synonyms | GDF8; MSLHP; GDF-8/Myostatin | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 267-375 of human GDF-8/Myostatin (NP_005250.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS | Uniprot ID | O14793 |
Uniprot Id
O14793
Target Species
Human
Target Name
MSTN
Target Full Name
Growth/differentiation factor 8
Target Function
Acts specifically as a negative regulator of skeletal muscle growth.
Target Involvement
Muscle hypertrophy (MSLHP)
Target Subcellular Location
Secreted.
Target Protein Families
TGF-beta family
Target Research Area
Signal Transduction
Target Synonyms
Cmpt; GDF-8; GDF8_HUMAN; Growth/differentiation factor 8; MSLHP; MSTN; MSTN myostatin; Myostatin; Myostatin Propeptide
Target Background
This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. This protein negatively regulates skeletal muscle cell proliferation and differentiation. Mutations in this gene are associated with increased skeletal muscle mass in humans and other mammals.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
