-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Gephyrin was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Gephyrin (NP_001019389) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Gephyrin was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Gephyrin (NP_001019389) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13901A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Gephyrin |
| Target Synonyms | GPH; GEPH; HKPX1; GPHRYN; MOCODC; Gephyrin | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, Hep G2, Mouse liver, Rat liver | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Gephyrin (NP_001019389). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MATEGMILTNHDHQIRVGVLTVSDSCFRNLAEDRSGINLKDLVQDPSLLGGTISAYKIVPDEIEEIKETLIDWCDEKELNLILTTGGTGFAPRDVTPEAT | Uniprot ID | Q9NQX3 |
Uniprot Id
Q9NQX3
Target Species
Human
Target Name
GPHN
Target Full Name
Gephyrin
Target Function
Microtubule-associated protein involved in membrane protein-cytoskeleton interactions. It is thought to anchor the inhibitory glycine receptor (GLYR) to subsynaptic microtubules. Acts as a major instructive molecule at inhibitory synapses, where it also clusters GABA type A receptors.; Has also a catalytic activity and catalyzes two steps in the biosynthesis of the molybdenum cofactor. In the first step, molybdopterin is adenylated. Subsequently, molybdate is inserted into adenylated molybdopterin and AMP is released.
Target Involvement
Molybdenum cofactor deficiency, complementation group C (MOCODC)
Target Subcellular Location
Cell junction, synapse, postsynaptic cell membrane; Lipid-anchor; Cytoplasmic side. Cell membrane; Lipid-anchor; Cytoplasmic side. Cytoplasm, cytosol. Cytoplasm, cytoskeleton. Cell projection, dendrite. Cell junction, synapse, postsynaptic density.
Target Protein Families
MoaB/Mog family; MoeA family
Target Synonyms
Domain E; Domain G; GEPH; GEPH_HUMAN; GPH; GPHN; GPHRYN; KIAA1385; Molybdopterin molybdenumtransferase; MPT adenylyltransferase; MPT Mo-transferase
Target Background
This gene encodes a neuronal assembly protein that anchors inhibitory neurotransmitter receptors to the postsynaptic cytoskeleton via high affinity binding to a receptor subunit domain and tubulin dimers. In nonneuronal tissues, the encoded protein is also required for molybdenum cofactor biosynthesis. Mutations in this gene may be associated with the neurological condition hyperplexia and also lead to molybdenum cofactor deficiency. Numerous alternatively spliced transcript variants encoding different isoforms have been described; however, the full-length nature of all transcript variants is not currently known.
Notification