Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GFRA2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 360-464 of human GFRA2 (NP_001486.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GFRA2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 360-464 of human GFRA2 (NP_001486.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04228A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GFRA2 |
| Target Synonyms | NTNRA; RETL2; TRNR2; GDNFRB; NRTNR-ALPHA; GFRA2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, HepG2, LO2, Mouse lung, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 360-464 of human GFRA2 (NP_001486.4). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DVNVSPKGPSFQATQAPRVEKTPSLPDDLSDSTSLGTSVITTCTSVQEQGLKANNSKELSMCFTELTTNIIPGSNKVIKPNSGPSRARPSAALTVLSVLMLKLAL | Uniprot ID | O00451 |
Uniprot Id
O00451
Target Species
Human
Target Name
GFRA2
Target Full Name
GDNF family receptor alpha-2
Target Function
Receptor for neurturin. Mediates the NRTN-induced autophosphorylation and activation of the RET receptor. Also able to mediate GDNF signaling through the RET tyrosine kinase receptor.; participates in NRTN-induced 'Ser-727' phosphorylation of STAT3.
Target Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor.
Target Protein Families
GDNFR family
Target Tissue Specificity
Isoform 1 is found in both brain and placenta.
Target Synonyms
GDNF family receptor alpha 2; GDNF family receptor alpha-2; GDNF receptor alpha-2; GDNF receptor beta; GDNFR beta; GDNFR-alpha-2; GDNFR-beta; GDNFRB; GFR alpha 2; GFR-alpha-2; GFRA 2; Gfra2; GFRA2_HUMAN; Glial cell line derived neurotrophic factor family receptor alpha2b; Glial cell line derived neurotrophic factor receptor beta; Neurturin receptor alpha; NRTNR alpha; NRTNR-alpha; NTNR alpha; NTNR-alpha; NTNRA; PI linked cell surface accessory protein; PI linked cell-surface accessory protein; RET ligand 2; RETL 2; RETL2; TGF beta related neurotrophic factor receptor 2; TGF-beta-related neurotrophic factor receptor 2; TRN receptor GPI anchored; TRNR 2; TRNR2
Target Background
Glial cell line-derived neurotrophic factor (GDNF) and neurturin (NTN) are two structurally related, potent neurotrophic factors that play key roles in the control of neuron survival and differentiation. The protein encoded by this gene is a member of the GDNF receptor family. It is a glycosylphosphatidylinositol(GPI)-linked cell surface receptor for both GDNF and NTN, and mediates activation of the RET tyrosine kinase receptor. This encoded protein acts preferentially as a receptor for NTN compared to its other family member, GDNF family receptor alpha 1. This gene is a candidate gene for RET-associated diseases. Multiple transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
