-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GJA8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 234-433 of human GJA8 (NP_005258.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against GJA8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 234-433 of human GJA8 (NP_005258.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-10622A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GJA8 |
| Target Synonyms | CAE; CAE1; CX50; CZP1; MP70; CTRCT1; GJA8 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Raji | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 234-433 of human GJA8 (NP_005258.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SALKRPVEQPLGEIPEKSLHSIAVSSIQKAKGYQLLEEEKIVSHYFPLTEVGMVETSPLPAKPFNQFEEKISTGPLGDLSRGYQETLPSYAQVGAQEVEGEGPPAEEGAEPEVGEKKEEAERLTTEEQEKVAVPEGEKVETPGVDKEGEKEEPQSEKVSKQGLPAEKTPSLCPELTTDDARPLSRLSKASSRARSDDLTV | Uniprot ID | P48165 |
Uniprot Id
P48165
Target Species
Human
Target Name
GJA8
Target Full Name
Gap junction alpha-8 protein
Target Function
Structural component of eye lens gap junctions. Gap junctions are dodecameric channels that connect the cytoplasm of adjoining cells. They are formed by the docking of two hexameric hemichannels, one from each cell membrane. Small molecules and ions diffuse from one cell to a neighboring cell via the central pore.
Target Involvement
Cataract 1, multiple types (CTRCT1)
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.
Target Protein Families
Connexin family, Alpha-type (group II) subfamily
Target Tissue Specificity
Eye lens.
Target Synonyms
GJA8; Gap junction alpha-8 protein; Connexin-50; Cx50; Lens fiber protein MP70
Target Background
This gene encodes a transmembrane connexin protein that is necessary for lens growth and maturation of lens fiber cells. The encoded protein is a component of gap junction channels and functions in a calcium and pH-dependent manner. Mutations in this gene have been associated with zonular pulverulent cataracts, nuclear progressive cataracts, and cataract-microcornea syndrome.
Notification