-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GLI1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 350-450 of human GLI1 (NP_001153517.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against GLI1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 350-450 of human GLI1 (NP_001153517.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-12901A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GLI1 |
| Target Synonyms | GLI; PPD1; PAPA8; GLI1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 350-450 of human GLI1 (NP_001153517.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LSSLDEGPCIAGTGLSTLRRLENLRLDQLHQLRPIGTRGLKLPSLSHTGTTVSRRVGPPVSLERRSSSSSSISSAYTVSRRSSLASPFPPGSPPENGASSL | Uniprot ID | P08151 |
Uniprot Id
P08151
Target Species
Human
Target Name
GLI1
Target Full Name
Zinc finger protein GLI1
Target Function
Acts as a transcriptional activator. Binds to the DNA consensus sequence 5'-GACCACCCA-3'. Regulates the transcription of specific genes during normal development. Plays a role in craniofacial development and digital development, as well as development of the central nervous system and gastrointestinal tract. Mediates SHH signaling. Plays a role in cell proliferation and differentiation via its role in SHH signaling.; Acts as a transcriptional activator, but activates a different set of genes than isoform 1. Activates expression of CD24, unlike isoform 1. Mediates SHH signaling. Promotes cancer cell migration.
Target Subcellular Location
Cytoplasm. Nucleus.; [Isoform 2]: Cytoplasm. Nucleus.
Target Protein Families
GLI C2H2-type zinc-finger protein family
Target Tissue Specificity
Detected in testis (at protein level). Testis, myometrium and fallopian tube. Also expressed in the brain with highest expression in the cerebellum, optic nerve and olfactory tract. Isoform 1 is detected in brain, spleen, pancreas, liver, kidney and place
Target Research Area
Developmental Biology
Target Synonyms
Gli 1; GLI; GLI family zinc finger 1; GLI Kruppel family member 1; gli1; GLI1_HUMAN; Glioma associated oncogene 1; Glioma associated oncogene homolog 1 (zinc finger protein) ; Glioma associated oncogene homolog; Glioma-associated oncogene; Oncogene GLI; Zfp 5; Zfp5; Zinc finger protein GLI 1; Zinc finger protein GLI1
Target Background
This gene encodes a member of the Kruppel family of zinc finger proteins. The encoded transcription factor is activated by the sonic hedgehog signal transduction cascade and regulates stem cell proliferation. The activity and nuclear localization of this protein is negatively regulated by p53 in an inhibitory loop. Multiple transcript variants encoding different isoforms have been found for this gene.
Notification