Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GMPR was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 60-120 of human GMPR (NP_006868.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GMPR was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 60-120 of human GMPR (NP_006868.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02290A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GMPR |
| Target Synonyms | GMPR1; GMPR 1; GMPR | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse kidney, 293T, K-562, Mouse spleen | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 60-120 of human GMPR (NP_006868.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TFEMAAVMSQHSMFTAIHKHYSLDDWKLFATNHPECLQNVAVSSGSGQNDLEKMTSILEAV | Uniprot ID | P36959 |
Uniprot Id
P36959
Target Species
Human
Target Name
GMPR
Target Full Name
GMP reductase 1
Target Function
Catalyzes the irreversible NADPH-dependent deamination of GMP to IMP. It functions in the conversion of nucleobase, nucleoside and nucleotide derivatives of G to A nucleotides, and in maintaining the intracellular balance of A and G nucleotides.
Target Protein Families
IMPDH/GMPR family, GuaC type 1 subfamily
Target Research Area
Cell Biology
Target Synonyms
GMPR; GMPR1GMP reductase 1; GMPR 1; EC 1.7.1.7; Guanosine 5'-monophosphate oxidoreductase 1; Guanosine monophosphate reductase 1
Target Background
This gene encodes an enzyme that catalyzes the irreversible and NADPH-dependent reductive deamination of GMP to IMP. The protein also functions in the re-utilization of free intracellular bases and purine nucleosides.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
