Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GORAB was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human GORAB (NP_001139511.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GORAB was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human GORAB (NP_001139511.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02092A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GORAB |
| Target Synonyms | GO; NTKLBP1; SCYL1BP1; GORAB | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-431, Mouse spleen, U-251MG, U20S | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GORAB (NP_001139511.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSWAAVLAVAAARFGHFWGCRWPGPMAQGWAGFSEEELRRLKQTKDPFEPQRRLPAKKSRQQLQREKALVEQSQKLGLQDGSTSLLPEQLLSAPKQRVNV | Uniprot ID | Q5T7V8 |
Uniprot Id
Q5T7V8
Target Species
Human
Target Name
GORAB
Target Full Name
RAB6-interacting golgin
Target Involvement
Geroderma osteodysplasticum (GO)
Target Subcellular Location
Cytoplasm. Golgi apparatus.
Target Protein Families
GORAB family
Target Synonyms
FLJ11752; GO; Golgin RAB6 interacting; GORAB; GORAB_HUMAN; hNTKL BP1; hNTKL-BP1; MGC51263; MGC70512; N terminal kinase like binding protein 1; N-terminal kinase-like-binding protein 1; NTKL binding protein 1; NTKL BP1; NTKL-binding protein 1; NTKL-BP1; NTKLBP 1; NTKLBP1; OTTHUMP00000033164; RAB6-interacting golgin; RP11 545I10.1; SCY1 like 1 binding protein 1; SCY1-like 1-binding protein 1; SCYL1 binding protein 1; SCYL1 BP1; SCYL1-binding protein 1; SCYL1-BP1; SCYL1BP1
Target Background
This gene encodes a member of the golgin family, a group of coiled-coil proteins localized to the Golgi. The encoded protein may function in the secretory pathway. The encoded protein, which also localizes to the cytoplasm, was identified by interactions with the N-terminal kinase-like protein, and thus it may function in mitosis. Mutations in this gene have been associated with geroderma osteodysplastica. Alternatively spliced transcript variants have been described.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
