Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GPHA2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 24-129 of human GPHA2 (NP_570125.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GPHA2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 24-129 of human GPHA2 (NP_570125.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01656A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GPHA2 |
| Target Synonyms | A2; GPA2; ZSIG51; GPHA2 | Form | Liquid |
| Species Reactivity | Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 24-129 of human GPHA2 (NP_570125.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QEAVIPGCHLHPFNVTVRSDRQGTCQGSHVAQACVGHCESSAFPSRYSVLVASGYRHNITSVSQCCTISGLKKVKVQLQCVGSRREELEIFTARACQCDMCRLSRY | Uniprot ID | Q96T91 |
Uniprot Id
Q96T91
Target Species
Human
Target Name
GPHA2
Target Full Name
Glycoprotein hormone alpha-2
Target Function
Functions as a heterodimeric glycoprotein hormone with GPHB5 able to bind and activate the thyroid-stimulating hormone receptor (TSHR), leading to increased cAMP production. Plays a central role in controlling thyroid cell metabolism.
Target Subcellular Location
Secreted.
Target Protein Families
Glycoprotein hormones subunit alpha family
Target Tissue Specificity
Found in a variety of tissues.
Target Synonyms
GPHA2; GPA2; ZSIG51; Glycoprotein hormone alpha-2; Putative secreted protein Zsig51; Thyrostimulin subunit alpha
Target Background
GPHA2 is a cystine knot-forming polypeptide and a subunit of the dimeric glycoprotein hormone family (Hsu et al., 2002 [PubMed 12089349]).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
