-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GPT was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human GPT (NP_005300.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GPT was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human GPT (NP_005300.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08803A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GPT |
| Target Synonyms | ALT; AAT1; ALT1; GPT1; SGPT; GPT | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat heart, Mouse intestine, Mouse liver, Mouse lung, Rat liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human GPT (NP_005300.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MASSTGDRSQAVRHGLRAKVLTLDGMNPRVRRVEYAVRGPIVQRALELEQELRQGVKKPFTEVIRANIGDAQAMGQRPITFLRQVLALCVNPDLLSSPNFPDDAKKRAERILQACGGHSLGAYSVSSGIQLIREDVARYIERRDGGIPADPNNVFLSTGASDAIVTVLKLLVAGEGHTRTGVLIPIPQYP | Uniprot ID | P24298 |
Uniprot Id
P24298
Target Species
Human
Target Name
GPT
Target Full Name
Alanine aminotransferase 1
Target Function
Catalyzes the reversible transamination between alanine and 2-oxoglutarate to form pyruvate and glutamate. Participates in cellular nitrogen metabolism and also in liver gluconeogenesis starting with precursors transported from skeletal muscles.
Target Subcellular Location
Cytoplasm.
Target Protein Families
Class-I pyridoxal-phosphate-dependent aminotransferase family, Alanine aminotransferase subfamily
Target Tissue Specificity
Liver, kidney, heart, and skeletal muscles. Expressed at moderate levels in the adipose tissue.
Target Research Area
Signal Transduction, Metabolism
Target Synonyms
AAT1; Alanine aminotransferase 1; Alanine aminotransferase; ALAT1_HUMAN; ALT1; Glutamate pyruvate transaminase 1; Glutamic alanine transaminase 1; Glutamic pyruvate transaminase (alanine aminotransferase); Glutamic pyruvic transaminase 1; Glutamic--alanine transaminase 1; Glutamic--pyruvic transaminase 1; GPT 1; gpt; GPT1
Target Background
This gene encodes cytosolic alanine aminotransaminase 1 (ALT1); also known as glutamate-pyruvate transaminase 1. This enzyme catalyzes the reversible transamination between alanine and 2-oxoglutarate to generate pyruvate and glutamate and, therefore, plays a key role in the intermediary metabolism of glucose and amino acids. Serum activity levels of this enzyme are routinely used as a biomarker of liver injury caused by drug toxicity, infection, alcohol, and steatosis. A related gene on chromosome 16 encodes a putative mitochondrial alanine aminotransaminase.
Notification