-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GRB2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 118-217 of human GRB2 (P62993) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ELISA.
The antibody against GRB2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 118-217 of human GRB2 (P62993) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ELISA.
| Cat.No | ADA-15971A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GRB2 |
| Target Synonyms | ASH; Grb3-3; MST084; NCKAP2; MSTP084; EGFRBP-GRB2; GRB2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, NIH/3T3, Rat brain, 293T, HL-60, MCF7, Mouse brain, Rat spleen | Application | ELISA, WB, IF/ICC, IHC-P, IP |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 118-217 of human GRB2 (P62993). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVPQQPTYVQALFDFDPQEDGELGFRRGDFIHVMDNSDPNWWKGACHGQTGMFPRNYVTPVNRNV | Uniprot ID | P62993 |
Uniprot Id
P62993
Target Species
Human
Target Name
GRB2
Target Full Name
Growth factor receptor-bound protein 2
Target Function
Adapter protein that provides a critical link between cell surface growth factor receptors and the Ras signaling pathway.; Does not bind to phosphorylated epidermal growth factor receptor (EGFR) but inhibits EGF-induced transactivation of a RAS-responsive element. Acts as a dominant negative protein over GRB2 and by suppressing proliferative signals, may trigger active programmed cell death.
Target Subcellular Location
Nucleus. Cytoplasm. Endosome. Golgi apparatus.
Target Protein Families
GRB2/sem-5/DRK family
Target Synonyms
Abundant SRC homology ; Adapter protein GRB2; ASH; Ash protein; EGFRBP GRB2; Epidermal growth factor receptor binding protein ; Epidermal growth factor receptor binding protein GRB2; GRB 2; GRB2 adapter protein; Grb2; GRB2_HUMAN; Grb3 3; Growth factor receptor bound protein 2; Growth factor receptor bound protein 3; Growth factor receptor-bound protein 2; HT027 ; MST084; MSTP084; NCKAP2; OTTHUMP00000166096 ; OTTHUMP00000166097; OTTHUMP00000166098; Protein ash; SEM5; SH2/SH3 adapter GRB2
Target Background
The protein encoded by this gene binds the epidermal growth factor receptor and contains one SH2 domain and two SH3 domains. Its two SH3 domains direct complex formation with proline-rich regions of other proteins, and its SH2 domain binds tyrosine phosphorylated sequences. This gene is similar to the Sem5 gene of C.elegans, which is involved in the signal transduction pathway. Two alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Notification